SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258510995|ref|YP_003184429.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258510995|ref|YP_003184429.1|
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 5.23e-21
Family Hypothetical protein YfhH 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258510995|ref|YP_003184429.1|
Sequence length 104
Comment hypothetical protein Aaci_1002 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
Sequence
MLYSEMSKEELRREMAELQRKGREAYERENWSEYEIYMTRWYLAKSYEIKDDVHIEIGRT
YRIAEEYDRLTVTAIEGVMAWGIRQMTGETTAVPIAQLEEADEA
Download sequence
Identical sequences C8WVB8
WP_012810386.1.29831 gi|258510995|ref|YP_003184429.1| 521098.Aaci_1002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]