SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258511466|ref|YP_003184900.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258511466|ref|YP_003184900.1|
Domain Number 1 Region: 259-555
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 8.24e-78
Family DNA repair protein MutS, domain III 0.00000133
Further Details:      
 
Domain Number 2 Region: 558-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-60
Family ABC transporter ATPase domain-like 0.000000761
Further Details:      
 
Domain Number 3 Region: 2-111
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.75e-43
Family DNA repair protein MutS, domain I 0.000029
Further Details:      
 
Domain Number 4 Region: 113-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 8.24e-20
Family DNA repair protein MutS, domain II 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|258511466|ref|YP_003184900.1|
Sequence length 867
Comment DNA mismatch repair protein MutS [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
Sequence
MSLTPMMRQYREIKSKLDDTLLMFRLGDFYELFFEDAVIASQALDITLTGRDAGEAGRVP
MCGVPHHALDGYLERLIEQGFRVAICDQVEDPKAAKGLVRREIVRIVTPGTAVTEESDAR
YLAALAFQGDEVGLALVDVGAGDVWFGAGSAEDMRDHVARFRPREILLEGAQAFPGWLEE
ILNRHGAIVTRVPAPSGDAFLMHYGASSPEALGLRPGSAALSACNMGFQYLRDTQMAALR
HLAPPRPLLEPGRMWLSERTVEHLELVPMGSGRERRTSLYDVIRETVTAAGSRLLRTWML
RPLVDRGAIEERLDAVTALADDLLLRAEIRESLKGMHDLSRLLAKCSIGRATPRDLLALA
HAIEKGEAAIALLPADGPALFSRLTRDLPDFRPLAEHIARELVDDPPASAAEGGIFRDGV
DAEIDRLRSLQSEGRSWLREFEARERERTGIKSLKIGYNKVFGYYIEVSKANLSLVPADY
ERKQTLAAGERFTHPELKAREADMLTAAERVVELERARFESWIHRVREQASELQRFAEVV
STIDVLAGLAELAVKRGYVRPEVTDDVGIEIREGRHPVVEASLGSEFVPNDLVLTPDAPI
ILLTGPNMGGKSTYMRQAALIAILAQMGSYVPARSARIGLVDRVFTRIGASDDLSRGQST
FMVEMTELAEILREASGRSLVLLDEIGRGTSTYDGLSIAEAVLEDLAERRDRPLTLFATH
YHELISFSERFSCVRNQSMAVEETDTGIRFLHTVVMRPSDRSYGIQVARLAGLPDRVIRR
AMEFLEAREAKPEVAAARDDRRERRRQEGQAREGGPVALDLFAAPYRDLVDWLAAQDVMR
MTPLEAMQVLHEAAEKARDLVGWERSR
Download sequence
Identical sequences C8WWP0
521098.Aaci_1486 gi|258511466|ref|YP_003184900.1| WP_012810824.1.29831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]