SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258512089|ref|YP_003185523.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258512089|ref|YP_003185523.1|
Domain Number 1 Region: 294-507
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-42
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 63-285
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.7e-20
Family DNA repair protein MutS, domain III 0.0097
Further Details:      
 
Domain Number 3 Region: 698-774
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000000196
Family Smr domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258512089|ref|YP_003185523.1|
Sequence length 776
Comment MutS2 family protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
Sequence
MDERALDALEYEDVRGEIAKCAQTSLGQARASAMVPFAERADAEAELARLDEAVRMLYRV
GAPPFAGIESLEEVVQRARRGGTISADEANRLARCIAGMRAMRQFVERAAEGGDFPLLAS
SVAPMADLRRTEQEIRQVVDEDGQVIDHASPTLLRLRDEKRRREAEIRTVLDRLLRTQAK
YLQEPVIAMRGEHYCLPVRVEHKSQIPGMVRDVSSSGSTVFIEPRAIVELSERVRELEVL
EEREVERLLYQLAAAVAQVADDFLRNLNVAAEMDFVFAKAAYARRVDGKRPRLTDGVWRL
HGARHPKLHRDAVPIDVELGDRFRLLIITGPNTGGKTVTLKTIGLLTLMGMSGLFLPTKR
ESDIGFCRHVFVDIGDEQSIEQNLSTFSSHMRRIIDMLERVTPDSLVLLDELGAGTDPAE
GSALAIAILDHLTSVGARVVATTHYAELKGYAFRNPAAENASMEFDVETLRPTYRLLMGV
PGRSNALAIAERLGMPKEILERARSHVAESDIHVEDLIGKLEAASREAERMRDEAEQALR
EARDQAADLARQKAAWEASKDSMREQAAREAREVIERARREADAVIREIRSLRDRAAVKD
HELVELRKRLEAAEPGEKRAAPRRRAQAEVRPGQRVRVLSLGQKGDVVEVAQDGRAAVVQ
LGAMRMKVDARDLEVVGDAQPAAAPSVTRLGGAKDVRMELDVRGETVDDAISRIDKYLDD
AVVAGISRVVIIHGKGTGALRNAIRRYLRDHPHVKSSEPAGPGEGGDGATVVHVRT
Download sequence
Identical sequences C8WQI9
WP_012811398.1.29831 521098.Aaci_2125 gi|258512089|ref|YP_003185523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]