SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258512093|ref|YP_003185527.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258512093|ref|YP_003185527.1|
Domain Number 1 Region: 217-395
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-64
Family B3/B4 domain of PheRS, PheT 0.00000632
Further Details:      
 
Domain Number 2 Region: 474-694
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.97e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 36-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-42
Family Myf domain 0.001
Further Details:      
 
Domain Number 4 Region: 702-802
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.09e-22
Family Anticodon-binding domain of PheRS 0.00046
Further Details:      
 
Domain Number 5 Region: 410-482
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.74e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258512093|ref|YP_003185527.1|
Sequence length 803
Comment phenylalanyl-tRNA synthetase subunit beta [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
Sequence
MRASYKWLAEYLDLAGLSPAELADRLTSAGLAVDAVDPLNRGVEGVVIGKILEVRPHPQA
DRLKVCRVDVGGRQLEIVCGAPNAAPGLVVPVALPGAKLPGGVEIRIAEFRGVSSHGMLC
SADELGIETRYLPKRDVEGLFVLPEDLPLGEDVVPHLHLDDVVLDLDLTPNRSDCLSIRG
LVHELSAILRRPHRFPASVPAPAAEGESPLQVRLETPRCPRYEAQLLEGVEVRETPLWMK
MRLLAMGVRSIDLVVDVTNYVMLEWGQPLHAFDADAIAHATIVVRQAREGERLVTLDGQE
RALTPDMIVIADPEKAIGLAGVMGGENSEIGPSTRRIALESARFDGASIRRTGQALSLRS
EAQQRFEKGVDPAAVSSALHRATELLVQLAGSRPVGAPRRVPAQADVSKPTVISFSPRAC
ARFLGVDVPEEEMRACFESLGFDVTQGENEWRVEVPTRRPDVQLPADLYEEVARLYGYDH
IPATSMRLPVEAPESSGQLMLVRKVRRALVDWGLHEVRTYALTSPEAEAPVAPSGVPVPL
LRPMSDDRRTLRRHLLPSLAEVARHNLAHQVLGGAIFEVGKVFLAASWPQEALPEERAVL
GMLWFGEPEGDPFERPRRYDFYDAKGVCDALLARLGIQATYRVSQHAYLHPGRQASIEVN
GEPVGLVGELHPDVGEAYEVERAVYAEFDLGRLLSLASSEVRVLPIPRHPASRRDLAVVV
PRELESQALVDAAWRTLGDRGDLRLVRVFDVYTGVGVPEGHKSLAVALWFQRDERTLTDA
EIDEAVEAVLRAWEAAFGAKLRA
Download sequence
Identical sequences C8WQJ3
521098.Aaci_2129 WP_012811401.1.29831 gi|258512093|ref|YP_003185527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]