SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258510676|ref|YP_003184110.1| from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258510676|ref|YP_003184110.1|
Domain Number 1 Region: 12-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.49e-52
Family Methylesterase CheB, C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 286-480
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.26e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00032
Further Details:      
 
Domain Number 3 Region: 1037-1194
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-45
Family Histidine kinase 0.0037
Further Details:      
 
Domain Number 4 Region: 863-969
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.34e-27
Family Flavin-binding PAS domain 0.015
Further Details:      
 
Domain Number 5 Region: 977-1046
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000122
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 
Domain Number 6 Region: 215-288
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000484
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0036
Further Details:      
 
Domain Number 7 Region: 780-858
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000209
Family Flavin-binding PAS domain 0.056
Further Details:      
 
Weak hits

Sequence:  gi|258510676|ref|YP_003184110.1|
Domain Number - Region: 661-744
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|258510676|ref|YP_003184110.1|
Sequence length 1215
Comment signal transduction histidine kinase with CheB and CheR activity [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
Sequence
MSQPHDLMRVPLYVVGIGASAGGLEALTNLFDKLAPDTGMAFVVIQHLSPNYRSFMAELL
GAHTSMPVLQAEDGMPLEPNRVYLNPPRKNVFVDAGRLVVQDHLTVKGELHLPIDGCLQS
IAEYAGDRAVAVILSGTGSDGSRGIVRVKQRGGRVFVQDETAKFDGMPKSAVATGTVDAV
LSPDAIAKELERIARGEQSVSTFSPPSVTIEDDGHEELDDARYQELLEILKSSTGIDYTV
YKRDGVIRRLRRRMGIENISDVNHYFEALRQNPDAVEALHKDLLIGVTRFFRDPQAFQVI
YQDVLPQIFANRQTEREVRVWVAGCSTGEEAYSLAILIQEFMESIGQIYNVKIFATDLDR
DAVAFASNGVYGTEIQNDVSAERLRKFFVPCERGYRVKPDIRKMIIFAPHNITKDPPFIN
TDLISCRNMIIYLRREIQEKVLSLFHFALHPKGFLFLGPSESIGRMSNSFVPINTKWNIY
QHQGASCANRRPIIPPVTVPVKSASLPASHMVERRVDADSWASSRQADPHTDELYRVFVE
EHFPPCIVLDEKNDVVSMHGDVNRYLSLASGRPSNHIHKMFPPSISVAIATGVSKLKKGS
REVIYDRVKVNDSPDSATVTLVIRQLSDRLNRFRSHALVMFREPEPLEAVVYAGDDVSST
VSQRVIELERELQMYQEKLQVTVEELETSNEELQATNEEIVAANEELQSTNEELHSVNEE
LLTINAEYQLNIQQLTELTNDLDNFLASTEIGTLFLERELKVKRFTPALTKEFHLLDIDV
GRPITHISHRLEYDEMIDDAKSVLANGEPIEREVHSKSGAWYAVRVLPYHTPEQAVKGVV
FTFVDITKIKKMNEELRKLSYAVEQSPSIVVITDTEGRIEYVNPKFCACTGSSVEEALGR
HLRDLNEWAEQNLSFDDVWSNLQAGERWTGEVPSRRKDGTLYWEQLSIVPILDETGRIIH
YLKVAEDVTEFRYTEELLRKSEMLSAVGELAAGIAHEIRNPLTALKGFTKLILSGSHSDS
YLEIMRGELDRIETIVNELLVLSKPQAVHIQRRNFADILRDVVMLLETQALLTHVDIELR
IPDEPIEILCVENQLKQVFINLLKNAIEAMPNGGTIEVTVERDGDHVVIRVRDEGVGIPQ
DKMKKLGEPFYTTKDKGTGLGLMVSFKIVEQHGGIIRYESKEGEGTTVTVRLPLDMNSKA
RGLTPGDLNPGTVYA
Download sequence
Identical sequences C8WTH9
521098.Aaci_0673 gi|258510676|ref|YP_003184110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]