SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222475726|ref|YP_002564247.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222475726|ref|YP_002564247.1|
Domain Number 1 Region: 11-64
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000102
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222475726|ref|YP_002564247.1|
Sequence length 223
Comment hypothetical protein Hlac_2792 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MTRRQTGWRHHATYLTNHTPLSERQAEILALKKTGHTTEEITEILTLYPETIEDHWDDVL
EQWNQAQELCTIMGPHPWGDGETRQSEDVDDTPWNLLSSAVMNYSDEERTQIELELYYGK
SFPMSDMYLLVEREIADTADHATKTTEHRSAHDANALRGHIYSDVESIDEYYLRWELLGK
AGIDPGADFTPSAESLLGRPISQTEADAARESAQDRVDMHTVE
Download sequence
Identical sequences B9LVX1 G2MQ08 W0K022
gi|345006991|ref|YP_004809843.1| WP_009486605.1.44229 WP_009486605.1.75361 WP_009486605.1.80915 WP_009486605.1.89349 gi|222475726|ref|YP_002564247.1| gi|345006991|ref|YP_004809843.1|NC_015955 416348.Hlac_2792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]