SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222475796|ref|YP_002564317.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222475796|ref|YP_002564317.1|
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.44e-33
Family Transposase IS200-like 0.0000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222475796|ref|YP_002564317.1|
Sequence length 143
Comment transposase IS200-family protein [Halorubrum lacusprofundi ATCC 49239]
Sequence
MVKSTRHAKYELYYHIVFVPKLGGSEGSADLAEQGSAQHRRSHLTGKTKERLETIFAEIC
EDKDLELVESEVMLNHVHLFIGSPPKNAPSLIVNWVKGISARKYNQRYDDRVKWTRSYYV
GTAGSASKDAIERYIAEQEGGDE
Download sequence
Identical sequences B9LW41
WP_012659247.1.44229 WP_012659247.1.80915 416348.Hlac_2871 gi|222475796|ref|YP_002564317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]