SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222479292|ref|YP_002565529.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|222479292|ref|YP_002565529.1|
Domain Number - Region: 36-168
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0414
Family Diacylglycerol kinase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222479292|ref|YP_002565529.1|
Sequence length 222
Comment peptidase M50 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSGTLQGRRIAGLYFSGTEIRDLLVAWLALGVAFTFFFVNGTAGFDRLLAAGIVPPLLVG
LLTAGVAFLLHEIAHKVVAVHYDQVAEFRADNSMLFLAVMSSLLGFIFAAPGAVHHRGRL
TPREHGHIALAGPVVNLLLTLVFLPALLLGPVVGSPVITLIGSRGIAINVFLAAFNLIPY
GPLDGKTVLDWSKGVWAGFFVLSVVLTIGLVFVGGLGFGGPF
Download sequence
Identical sequences B9LUY2
gi|222479292|ref|YP_002565529.1| WP_015909610.1.44229 WP_015909610.1.66911 WP_015909610.1.80915 416348.Hlac_0861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]