SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222479567|ref|YP_002565804.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222479567|ref|YP_002565804.1|
Domain Number 1 Region: 3-295
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-58
Family Diacylglycerol kinase-like 0.0000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222479567|ref|YP_002565804.1|
Sequence length 303
Comment diacylglycerol kinase [Halorubrum lacusprofundi ATCC 49239]
Sequence
MADTVIIYNPQSGGGSHADDVEDRADLSGYAVERSEHAGEAVTLTQEAIEAGYSTIVAGG
GDGTVNEVVQGIDRADAFDDVTFGILPLGTGNNFAKQIGITDLETAFIALDDGVRRTIDI
GMATDRPFVNSCVAGLTAESVSGTSGALKSRIGGLAYVLTTLRTVTDFEPLQLTIDNEMS
DGDTPTWSGEALCVVVGNGRQFAADGTTQANMEDGLFEVAIVTDVPAIDLMSDAVLERLF
GQDSPHIDRFQAASVDIRGHSSDPIRFSVDGETIEQRDLVLTVRPNRLRLVVGEGYDPSP
MDT
Download sequence
Identical sequences B9LMZ6
WP_015909879.1.44229 WP_015909879.1.66911 WP_015909879.1.80915 gi|222479567|ref|YP_002565804.1| 416348.Hlac_1140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]