SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222479855|ref|YP_002566092.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222479855|ref|YP_002566092.1|
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-30
Family GHMP Kinase, N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 182-326
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.18e-29
Family Mevalonate 5-diphosphate decarboxylase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222479855|ref|YP_002566092.1|
Sequence length 332
Comment GHMP kinase [Halorubrum lacusprofundi ATCC 49239]
Sequence
MTEKATARAHPIQGLVKYHGMRDPELRLPYHDSISLCTAPTATTTTVEWQPDASEDVYVI
GDEEVDGRAAERIDMVVEHVRELAGVDAAVRLESENSFPSNIGFGSSSSGFAAAALALTE
AAGLDLTLPDISTVARRGSSSAARSVTGAYSRLDAGLNDEDCRSHRLDVGVGDDGFDPEE
DLRIVAAHVPAYKETEEAHREAAASHMMQARTAHVQDQLVEMTDALREGDFDRICGTAEH
DSLSLTATTMTGPAGWVYWQPETIAVFNAVRELREEGVPVYFSTDTGASVYVNTLAGHAE
EVEERIAEIGIDTDIWEVGGPAHLLDENEALF
Download sequence
Identical sequences B9LNT4
gi|222479855|ref|YP_002566092.1| WP_015910164.1.44229 WP_015910164.1.66911 WP_015910164.1.80915 416348.Hlac_1434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]