SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222479972|ref|YP_002566209.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222479972|ref|YP_002566209.1|
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily Globin-like 6.04e-31
Family Truncated hemoglobin 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222479972|ref|YP_002566209.1|
Sequence length 121
Comment globin [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSDSQSIYATIGGQEAVEAVVSDFYDRVFDDPVLEPYFEGVDREALYAHQVQFISAVAGG
PVSYDGADMRAAHEGMGVTEEAFGRVATYLAEALRENGVAEANVETILDEVGALEPDVVG
Q
Download sequence
Identical sequences B9LP51
gi|222479972|ref|YP_002566209.1| 416348.Hlac_1552 WP_015910279.1.44229 WP_015910279.1.66911 WP_015910279.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]