SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222480082|ref|YP_002566319.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480082|ref|YP_002566319.1|
Domain Number 1 Region: 34-87,245-441
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.13e-41
Family Bacterial dinuclear zinc exopeptidases 0.0093
Further Details:      
 
Domain Number 2 Region: 108-189
Classification Level Classification E-value
Superfamily PA domain 0.00000000000732
Family PA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222480082|ref|YP_002566319.1|
Sequence length 479
Comment peptidase M28 [Halorubrum lacusprofundi ATCC 49239]
Sequence
MHSEPNETNAAVDPAAVERVRERRTELAPALGRTWTDGDPWRFLTDLTAIGSRMAGSEGE
RRAAEIVADAFERAGLSAVETRPFEMAAWERGSATLRVTAPGRDGAAATREFEALALPYS
PGGSVTGELVDVGYGTPAEIDEREVEGRIAVASTTTPEGGRFVHRMEKFGYALDAGAVGF
VFVNHLDGQLPPTGSLTFGEEAEAVAVGVSKETGAWLREYAAGGDGGVAAESSPAAQAEL
SVTATTEPGESRNVVGHAGPDTDERLLLLAHYDAHDIAEGALDNGCGIATVATAAGILTE
ADLPLGVDVVAVGAEEVGLLGSEQLAERLDLDRVKGVINVDGAGRFRDLVALAHASETAA
SVAEAVSTATNQPIAVDAEPHPFSDQWPFVRRGVPAIQLHSDSGDRGRGWGHTHADTRDK
VDDRNVREHAMLIALLVAEFAAPERDAPRLDRDDLIAAFRDADFETGMRAADLWPAGWE
Download sequence
Identical sequences B9LPG1
gi|222480082|ref|YP_002566319.1| 416348.Hlac_1664 WP_015910387.1.44229 WP_015910387.1.66911 WP_015910387.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]