SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222480241|ref|YP_002566478.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480241|ref|YP_002566478.1|
Domain Number 1 Region: 2-182
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-42
Family GHMP Kinase, N-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 187-336
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 9.66e-27
Family Mevalonate kinase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222480241|ref|YP_002566478.1|
Sequence length 338
Comment mevalonate kinase [Halorubrum lacusprofundi ATCC 49239]
Sequence
MTVCEAPGKVYLFGEHAVVYGEPAVPAAIERRATVTAEPRSDDHVRVEAEDLSLNGFTVE
YAGGTGDRPDVDVPAPLVEAAMGYVDAAVRQARDAADAPDAGFDITVESDIPLGAGLGSS
AAVVVAGIDAATRALGEPLDRRELADRAYHAEYEVQDGQASRADTFCSTMGGAVRIEGDD
CEPIEAPNLPFVVGFDGGAGDTGELVAGVGELREEYGFAADTVESIGDVVRTGEKLLADA
VSEADPSPELLAELGELMDFNHGLLSALGVSARSLDAMVWAARDAGAHGAKLTGAGGGGC
IVALDASDASETALSFTHGCEEAFRAELATEGVRVVEP
Download sequence
Identical sequences B9LPX0
WP_015910542.1.44229 WP_015910542.1.66911 WP_015910542.1.80915 416348.Hlac_1829 gi|222480241|ref|YP_002566478.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]