SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222480272|ref|YP_002566509.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480272|ref|YP_002566509.1|
Domain Number 1 Region: 249-504
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.83e-57
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 19-202
Classification Level Classification E-value
Superfamily Globin-like 7.2e-27
Family Globins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222480272|ref|YP_002566509.1|
Sequence length 505
Comment methyl-accepting chemotaxis sensory transducer [Halorubrum lacusprofundi ATCC 49239]
Sequence
MSSQGTHRDDELGIDDDTRATVDGEELLNNLEINAAEIERRKRHSRFDERDAARLSSIAD
DVDAVADDIVDEFYDHIDSDPEVRAVLDRSSLPMSALVAGQRRYLTGVVGGDYGRDYFAD
RARVGRLHDLLGLEPDAYLGQYAVYYERLFDVLAERAVDGNGENRNSEGGATDDTAEAVE
QFRDEALSVLKAFLLDQQLAIDTYVDSYVTEAEREARRQRELSRRVAEQIGEPAAALRET
TAEVAEESDRIDELAGRQSDRMDDLSREANEMTATVEEVAATADEVAATSDDAAGLAAEG
VDAASDATETMEEVREATEAVREEMADLQEQVDEIRGVTDVIGDVADQTNLLALNASIEA
ARAGEAGSGFAVVADEVKSLAQDASDHAADIEDTVEEVADSGEATLDELERVADRVADGT
EQVDETVTRLEAIESAVVDASDGIAEVSDAMDSQATSVEEVAAMVDDSTESAETVANSAS
EIAATTDRQRERVDEIADSAAELTE
Download sequence
Identical sequences B9LQ01
416348.Hlac_1861 WP_015910569.1.44229 WP_015910569.1.66911 WP_015910569.1.80915 gi|222480272|ref|YP_002566509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]