SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222480711|ref|YP_002566948.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480711|ref|YP_002566948.1|
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.72e-32
Family GHMP Kinase, N-terminal domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 154-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.29e-25
Family Homoserine kinase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222480711|ref|YP_002566948.1|
Sequence length 293
Comment homoserine kinase [Halorubrum lacusprofundi ATCC 49239]
Sequence
MVTVRAPATSANLGSGFDVFGAALTRPADVVTVEKAAETTIEVTGVGAQYIPEDPKKNTV
GAVVEALDAPARIHIDKGVRPASGLGSSAASAAGAAVALNRLYDRGLSRSELVPIAAEGE
AVVSGVAHSDNVAPSILGGFTVTTSEGTHAVDASIPLVVCLPDVAVSTRDARRVVPETAS
MDDLVETVGNAATLAIGMCRSDPDLVGAGMSDPVVTPERARLITGYDEVRAAAFDAGATG
VTVSGAGPAILAVCRDGQRRGVAAAMLDAFSDAGIDSRAYQTRIGRGSTVLEE
Download sequence
Identical sequences B9LS04
gi|222480711|ref|YP_002566948.1| 416348.Hlac_2302 WP_015910999.1.44229 WP_015910999.1.66911 WP_015910999.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]