SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222480977|ref|YP_002567214.1| from Halorubrum lacusprofundi ATCC 49239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222480977|ref|YP_002567214.1|
Domain Number 1 Region: 123-206
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 1.31e-20
Family Prokaryotic DNA-bending protein 0.00022
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily IHF-like DNA-binding proteins 9.42e-19
Family Prokaryotic DNA-bending protein 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222480977|ref|YP_002567214.1|
Sequence length 206
Comment histone family protein DNA-binding protein [Halorubrum lacusprofundi ATCC 49239]
Sequence
MNKAELIESMASESGLSKSDAKRALDTFTDATTKALEKGDSAVLVGFGSFSISKRSARTG
RNPSSRNGPVDDSPVTFDACPEFAAALDLNPGKGDEASAKCRDADVVIDAKYIASETRRN
SHEGLSEDDAKWALEAFINATTKALKKGDRLSLGEEEDENKGFGTFSISKRSARTGRNPQ
TGKEIQIAAKNVVKFKAGAELSKAVK
Download sequence
Identical sequences B9LTH2
416348.Hlac_2572 gi|222480977|ref|YP_002567214.1| WP_015911256.1.44229 WP_015911256.1.66911 WP_015911256.1.80915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]