SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257063590|ref|YP_003143262.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257063590|ref|YP_003143262.1|
Domain Number 1 Region: 9-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.65e-63
Family G proteins 0.000000151
Further Details:      
 
Domain Number 2 Region: 308-400
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.32e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000835
Further Details:      
 
Domain Number 3 Region: 211-307
Classification Level Classification E-value
Superfamily Translation proteins 5.89e-29
Family Elongation factors 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257063590|ref|YP_003143262.1|
Sequence length 400
Comment translation elongation factor 1A (EF-1A/EF-Tu) [Slackia heliotrinireducens DSM 20476]
Sequence
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAISKTLSMNDGSHGTAHADFTAFEDIDKAP
EERERGITISIAHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVIAATDGPMA
QTREHILLARQVGVPYIIVFLNKCDMVDDDELIELVEMETRELLTEYEFPGDDLPIIKGS
ALKALEEDPEWVAPIWELMDAVDEYIPTPERDVDKPFLMAVEDTMTITGRGTVATGRVER
GVLHLNDPLEIVGIKETQTTVCTGIEMFRKLLDEAQAGDNIGCLLRGIKRENIERGQVLC
KPGTVTPHTEFEGQVYILTKEEGGRHTPFFNNYRPQFYFRTTDITGSVKLPDGVEMVMPG
DNVTIVGELIHPIAMEEGLKFAIREGGRTVGSGRVTKIIK
Download sequence
Identical sequences C7N4S8
gi|257063590|ref|YP_003143262.1| 471855.Shel_08650 WP_012798017.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]