SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257063870|ref|YP_003143542.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257063870|ref|YP_003143542.1|
Domain Number 1 Region: 28-137
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.92e-22
Family Siroheme synthase N-terminal domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 133-231
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 3.14e-19
Family Siroheme synthase middle domains-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257063870|ref|YP_003143542.1|
Sequence length 246
Comment siroheme synthase, N-terminal domain-containing protein, partial [Slackia heliotrinireducens DSM 20476]
Sequence
MRLAKEKRTMTKPSLNISQKEATQDFAPYPLFIYLEELDVVVIGAGRVAERKIETLLDCG
ATVTAIAPKATQTVLKLAEEGRISYIQRCYKHGDLEGAILAVVATDNTPVNEAAYAEAVE
RHMLVNVVDVPHLCNCIVPSIMRRGKLQVAVSTAGAAPTVAKKIRRRLEEQYPAYWEDYV
DLLGDVRNLVKAHVPGPASIRTPLYEAVSAAGLEDRIKNGETISAVEVFETIVMPLAKDL
GIEVAA
Download sequence
Identical sequences C7N5K8
gi|257063870|ref|YP_003143542.1| WP_012798296.1.33174 471855.Shel_11590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]