SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257064029|ref|YP_003143701.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257064029|ref|YP_003143701.1|
Domain Number 1 Region: 179-280
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.46e-37
Family PTS system, Fructose specific IIB subunit-like 0.0000697
Further Details:      
 
Domain Number 2 Region: 1-146
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 2.35e-36
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257064029|ref|YP_003143701.1|
Sequence length 646
Comment PTS system D-fructose-specific transporter subunit IIABC [Slackia heliotrinireducens DSM 20476]
Sequence
MRIVDLLKEGSIKIGATAADKPDAIEQLIALHEKAGNLNDVEEYRKAILAREAGGTTAIG
EGMAIPHAKTDAVAQPALAAMTVPDGVDYEAPDGKPSNLLFMIAAPSDGDVHLEVLSRLM
TMLMDMDFRSKLLGASTPAEFLQIIDAKEIEKFGEPEPAAEATAPAAAAVATAEPEGYRV
LAVTACPTGIAHTYMAAEALAQEAEKMGVPIKVETNGSGGAKNILTADEIAAAEGIIVAA
DKNVEMARFDGKPVVITKVADGINKPKELINRALDGSAPLYHHTGAVDSAADSAEGESIG
RQIYKHLMEGVSHMLPFVVAGGIFIALAFLIDTLLGAPQDGNFGSNTPVAAWFKGIGGVS
FGFMLPILAGYIGRSIADRPGLLVGFVGGSMAAAGCTFADPAGQAVSAGFLGALLAGFAG
GYFMLWFEKVCENIPQALDGMKPMLIYPLVGLAFIGIFMCAVNPIMIAINAGISSFLTSL
GSAKILLGILLGGMMAIDMGGPINKAAYLFGLAAIESGNYDMMAAVMIGGMVPPLAIALA
CTFFKDRWTETELKSAPVNYIMGLSFITEGAIPYAAADPLRVIPACVVGSAVAGAISMAF
GCTLMAPHGGIFVFAVVGNWPMYLVALAIGAVVGALMLRVLKKKVA
Download sequence
Identical sequences C7N617
gi|257064029|ref|YP_003143701.1| WP_012798454.1.33174 471855.Shel_13280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]