SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257064612|ref|YP_003144284.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257064612|ref|YP_003144284.1|
Domain Number 1 Region: 10-205
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.27e-54
Family Class I glutamine amidotransferases (GAT) 0.0000225
Further Details:      
 
Domain Number 2 Region: 189-435
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.72e-48
Family N-type ATP pyrophosphatases 0.00000914
Further Details:      
 
Domain Number 3 Region: 405-536
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 8.76e-47
Family GMP synthetase C-terminal dimerisation domain 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257064612|ref|YP_003144284.1|
Sequence length 536
Comment GMP synthase [Slackia heliotrinireducens DSM 20476]
Sequence
MNESTFPEQKVVVLDFGAQYGQLIARRVRDLGVFSTIAPCDIPAEELADMKPSAIILSGG
PASVYAEDAPTIDPAVLELGVPVLGFCYGHQVIAVTLGGRVGHTEKGEYGHADITRCDGG
TSKLFGSTPSQQQVWMSHRDAVIQVPEGFRVTSQTAICPVASMECPDRNLYSTQFHPEVR
HTPYGQDLLGNFLFNICGLQPNWTMEGIIEDSVRAIQEQVGDSRVILGLSGGVDSSVVAA
LCARAIGSRLTCVFVNHGLLRKNEPEEVEEVFTKQFDVDFVHVHAEERYAGLLAGVVDPE
EKRRIIGTQFWNEFFAVAQDIAEDGRPVQFMAQGTIYPDIIESGARKTGGKASTIKSHHN
LIPFPEGVHFDLIEPLDHFFKDEVRALGTALGLPDYIVHRQPFPGPGLAIRIIGDVTPEK
LEILKNADAIIREELDAYNAKLFEETGERNSEHSCWQYFAVLPDIKSVGVMGDERTYQRP
IILRAVESSDAMTADWAKLPYEVLARVSGRIVAEVPGVNRVLYDITSKPPATIEWE
Download sequence
Identical sequences C7N7Q0
WP_012799037.1.33174 471855.Shel_19190 gi|257064612|ref|YP_003144284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]