SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257065015|ref|YP_003144687.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257065015|ref|YP_003144687.1|
Domain Number 1 Region: 7-62
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 3.4e-19
Family Ribosomal protein L30p/L7e 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257065015|ref|YP_003144687.1|
Sequence length 64
Comment 50S ribosomal protein L30P [Slackia heliotrinireducens DSM 20476]
Sequence
MADEQKKTLHITQVKSSIGYKHDQGETLKALGLGKIGRTVHKVDNPCIRGMIFKVKHLVE
VVED
Download sequence
Identical sequences C7N1P7
gi|257065015|ref|YP_003144687.1| 471855.Shel_23290 WP_012799438.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]