SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257065270|ref|YP_003144942.1| from Slackia heliotrinireducens DSM 20476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257065270|ref|YP_003144942.1|
Domain Number 1 Region: 126-208
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000018
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257065270|ref|YP_003144942.1|
Sequence length 210
Comment hypothetical protein Shel_25880 [Slackia heliotrinireducens DSM 20476]
Sequence
MAFDFKKEYRDLYRPKTTPSVVQVPPMCFLAVEGEGDPNQQDGAYQHALSLLYAVAYTLK
MSYKTDYAIDGFYEYVVPPLEGFWWQPGVAGVDPTDKASFRWLSVIRVPEFITEADFTWA
KAEAQRKKKLDCSPVQLIEIDEGLCVQCMHVGPYDDEPATAEAMHRFAAEAGYVPDFTDA
RRHHEIYLSDPRKADPAKMKTVVRHPVRPV
Download sequence
Identical sequences C7N2T5
WP_012799691.1.33174 gi|257065270|ref|YP_003144942.1| 471855.Shel_25880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]