SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256389450|ref|YP_003111014.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389450|ref|YP_003111014.1|
Domain Number 1 Region: 13-225
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000114
Family Galacturonase 0.069
Further Details:      
 
Domain Number 2 Region: 421-493
Classification Level Classification E-value
Superfamily PKD domain 0.00000000017
Family PKD domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256389450|ref|YP_003111014.1|
Sequence length 848
Comment PKD domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MPFLAANARADTVAATVFVGSTSGAPCSDTAAAAGSAATPFCAIQPAIDSPLTGPGTTVL
VAAGAAYLGQVNLDKSGTSADPIVLRSASPAQGSRAVIRGTVSVNGAHDVTVDGFDIYAD
TFGVNIEASSDVVVTRDHIEGPHDSSVADSGIMIAMASSAVTVSTDFVRGFGGGGLFADS
VSGLNIVADTITRNTTPSAGLDSIEVTGTSSGVAVADDIIDAAPSLPAGSAVDYNVIDAG
AVGPHDITGDGLAGSTDGDITPGDTSPAIDSAEEAATGELPTDMFGNAAADDPLVPNAGT
GSRVRDRGAVERTHGDTSYVLTLTPASGDAPLAVTATVTEHVGWAQQPRAAFYSFGFGGT
EQPATANPTARHTYTTPLYGGDVSVTIYDSAHEAIGYTTALVNVGQPVHATLSVAAASGL
NVNAVGSVQGGVGDWSIDFGDGYSTNFYSQTQATANHSYAKPGTYKVTLTANGILPSNAA
KLTQQVTVTAPPAPPPIVDTDPLVHRIAGSDRYATSIVASQVRWSAANSVDGAPAEDQAQ
AVVLARGDAFPDALAGVPLAAYKHGPLLLTDPKTVSQATLEEIRRVLPAGGNHTIYILGG
KTAVSPSVEAELRGLGYNVVRYGGTDRYGTALLIAHLGLGDPRHLIIAIGGDFADALAAG
PFAADSAEVVDGKPAAILLSGKANGNDTITDAGTAAYIDAKVQSNGGLSHCTDPNLITAV
GGPALTAFLNQEHKATKYACVDGIVGADRYATSSQLAGQWTNPEHPGVAVGTTFPDALSG
GAYEASLGQPLLLTNPTSLPSSTATALASMYPPHENTRTRSVVIFGGTSAVSSAVENQII
AKVHGRAQ
Download sequence
Identical sequences C7QJ31
gi|256389450|ref|YP_003111014.1| 479433.Caci_0218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]