SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256389729|ref|YP_003111293.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389729|ref|YP_003111293.1|
Domain Number 1 Region: 23-349,383-427
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.13e-34
Family Chondroitinase B 0.064
Further Details:      
 
Domain Number 2 Region: 652-980,1018-1070
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.98e-26
Family Pectate transeliminase 0.04
Further Details:      
 
Domain Number 3 Region: 521-639
Classification Level Classification E-value
Superfamily PKD domain 0.000000131
Family PKD domain 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|256389729|ref|YP_003111293.1|
Domain Number - Region: 1187-1270
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00526
Family CoA-binding domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256389729|ref|YP_003111293.1|
Sequence length 1412
Comment cell wall binding repeat 2-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MRARRVTLAALSALGVSVGVASAPAHAAAPTTIYVDNGSAACSDTGSGTQDQPFCTINAA
AKSAAPDDTVLIEPGTGHYSEPMMNIQTSGTPGHPITYQAAQGTFTMGNVNSPGQYDAAY
GLRFDQTVHDIVIQGFHFGGGLWVDEESARFQVRNNFFDGSGLAMYDGEAMEVTGNTFTN
APLSVEGAMGGISEPTPTLVDHNTVVGGSIWADMGSTTVTHNTVSGSSTFGILAGTNKSS
SMWDAQVTIAGNLVYGNAGGGISAANWGATITGNTIADNGGNQVEIHSPTPIPYTPPSPP
QTHVENNIIATGTTLPHSAAATASQIGITVDQAAWATTFVDRNVVSLAQGRPYEIGTTIV
PDGAHLAALGHGGTAEINAAPLLNADGTLRAGSPAVDSADSAAAGEQATDLAGNTRHDDS
GVCDTGAGSRSYDDRGAFEFQGTTSPAVACAAPTAPVPAAPAPTVDSVDFPATGGYFGVG
RAGYFHVADHSGARNPIQFSVDGGVAQQLLADASGSLMIPYTATTAGPHWIDVQVVGASP
SLTTRYTFTVPATDTVVAPTAYFTVAGDRANPKSVTVNAIKSLHGTTPIQSFTYHFGDGT
STGPTSATSATHIYSTADKFPITVTVQDTDSLSNSMQATYDASTGQTSTPKPSPNTIHVN
NAAGANCSDAAGSGSASKPFCTIAAAAALTNPGDTVLVSAGTYASGVDITRSGTPGDPIT
YTTSGTVDLVSPSNAAYMGTAFTLSGVHDVTVHGFVMDTKGSNGVLVGNSQNVEISGNTI
NDDGVFGASTYEGVQFTNVTDSAIVDNTVNAGDIQGIVVDSGSLRAAIQGNTVRATRNVV
YYTMIQDAAPNSTVVGNRVSNPESRDIAISSGADGTVVAGNMATCSNVGISVDANNVAVT
ANTVMQTAGRELAVGGNGNVTGTSIRDNVFAIPDNTFDCGSPNDGSIGMYGVDIYAGSTA
GTTLDHNDVWFPLYGPGYQWGDTEYAVTTPAQLAAFTTATGQSAHDTVAWPMLDANGAPR
PGSPTIDAADSSATGYPDKDLLGNPRVDDSTTPNTGLGPIAYGDMGAVEYQPQAPGGGTP
TPTPTPTPPPTPTPAPVPNPGTGQPTVQRLGGGTRYATGLMVSQHQWAAGKASAVVLARG
DAAPDALAGVPFAAHVHGPLLLTDPSALDSETRSEIDRVLGGPHSGKTVYILGGAGAVAP
SIEKGLRDAGYKVVRYGGDSRFSTALQIASAFGPTDHVIVATGRNFPDALSAGSLGAAEG
APIVLSDDTVLDAATAAFVARHPAIDPVGVQAQHAVAGLAAGRTVDRSLAGSDRYVTATD
VATRVAQILGHTPATVGVASGTAFPDALTGGAFIANAGGALVLTDPTRLTASTGALLTGW
HGGLSTIEVFGGPLAVSGPTYDAIVKTVGARS
Download sequence
Identical sequences C7PXA1
gi|256389729|ref|YP_003111293.1| 479433.Caci_0505 WP_012784747.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]