SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256389730|ref|YP_003111294.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389730|ref|YP_003111294.1|
Domain Number 1 Region: 64-123
Classification Level Classification E-value
Superfamily PKD domain 0.00000116
Family PKD domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256389730|ref|YP_003111294.1|
Sequence length 448
Comment cell wall binding repeat 2-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MSRSIGFGLALVAVLGTGLGPIAPVHADPAASPAKLSHVSPLFQPSLTVTAQNDHGLIAV
TMPAAGGQYSLSMGDGTTLRGADNQPEIYYTYQASGRYLVQLADTDAGGSTGTAAVWVDV
TVATAPPLAHAVARISGGDRYATAIAVSRTAWTGGSAKAVVLARGDKYPDALSGVPLAAH
VGGPLLLTDPTVLDTATRAEIDRVLGGPASGRTVYILGGTAAISPGVEKGLVSAGYHVVR
YSGADRAGTALAVAQQAFTSAPGALIATDTDFADALAAGPLAAALGEPILLTGQWTISDG
AWNWLQQHPRVGTVGEPALAVISERAMHGWGNIRANDGFQGPDRYTTALAVAHAMIDQTS
GSLPPGRSTGVCFASGETFPDALSGGALCALQNRPMLLLPATGGEGDVLAALDHWNGALS
QAELFGGPAALSQTAEDQVAQALSFTEN
Download sequence
Identical sequences C7PXA2
gi|256389730|ref|YP_003111294.1| 479433.Caci_0506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]