SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256390886|ref|YP_003112450.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256390886|ref|YP_003112450.1|
Domain Number - Region: 74-213
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000347
Family Bifunctional DNA primase/polymerase N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256390886|ref|YP_003112450.1|
Sequence length 236
Comment bifunctional DNA primase/polymerase [Catenulispora acidiphila DSM 44928]
Sequence
MPRSWRPAKNRKREHAASLVGVRDGVRDGVRAEGLLDPLDRLVAAGFAVVPAAAPREGSC
SCDRLGCPTPAAHPLSRAWQVEASTDPERLALWRARHPEANYVTPTGKTHSVLDVPDDVG
ADALRRILVAGTAPGPVAEADGRYLFFTAPRTNPDTDDVDEDEWWSSSLDCRPETLQEHP
GLRWHDRGSYVFVPPSVNMAGSTARWVYWPADGTPLPDAVVVLEVLADVLAEFSAA
Download sequence
Identical sequences C7QBN2
gi|256390886|ref|YP_003112450.1| WP_012785903.1.73754 479433.Caci_1688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]