SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256391500|ref|YP_003113064.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391500|ref|YP_003113064.1|
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.79e-17
Family DNA-binding N-terminal domain of transcription activators 0.0054
Further Details:      
 
Domain Number 2 Region: 121-268
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000471
Family Rob transcription factor, C-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391500|ref|YP_003113064.1|
Sequence length 268
Comment MerR family transcriptional regulator [Catenulispora acidiphila DSM 44928]
Sequence
MLTSGEFSRRARLSPKALRLYDQQGLLVPDEVDAVSRYRRYRVGRLADARLIVWLRRLDM
PLADVARVLAAPAAEREALVAAYWEAAEAKFAAQRWLAARVREEVSGHEGAHRMTQEILT
RDVPAQLVLTEQRHVTPEELPGWIGQAMMRLLAAADPVGGPAADPFVVYHGEINHDSDGP
AEVCVPVDPARAAALTAPTREEPAHREAYLRITKAQVEFPQILSAYDAVSRWLTAAGHTA
ALPPREVYFTDWDAAGPDDDVCDIAFPI
Download sequence
Identical sequences C7QJK0
gi|256391500|ref|YP_003113064.1| 479433.Caci_2305 WP_012786516.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]