SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256391537|ref|YP_003113101.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391537|ref|YP_003113101.1|
Domain Number 1 Region: 20-335
Classification Level Classification E-value
Superfamily Aldolase 3.85e-84
Family HMGL-like 0.00000000829
Further Details:      
 
Domain Number 2 Region: 472-573
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 2.62e-24
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.00038
Further Details:      
 
Domain Number 3 Region: 403-452
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0000000000000471
Family DmpG/LeuA communication domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256391537|ref|YP_003113101.1|
Sequence length 573
Comment 2-isopropylmalate synthase [Catenulispora acidiphila DSM 44928]
Sequence
MPSHRYRSVFDRVEVPLTDRTWPDQRFSAAPLWVPVDLRDGNQALAEPMDTARKTKMFDL
FLRMGYKEIEVAYPSASQTDFDFVRSLAVRDDIPEDVTISVFTPARPELIERTFESVEGL
PNVLVHLYTATAPAWRDLVLRGSRAEVLALIEDAAGLVAKLADQRLGTKHGPGAGRMRFE
FSPEVFNLTEPDYVIEVCDRVTEIWDACADRPVVHNLPATVEVATPNVYADQIEYMSRSL
ARREHVILSVHPHNDRGTGVACAELAVLAGAQRVEGCLFGNGERTGNVDLVTLALNLHAQ
GVDPMIDLSDIDAVKAVVEECNRIPVHVRHPYGGDLVYTAFSGTHQDAISKGMAHHAARA
AELGVPASQAPWDVPYLPIDPADVGRSYQGVIRVNSQSGKGGIAYLLRTHYGVDLPRDFQ
PGFSKVVQRATDEHGREMTPQDLWELFRTTYVVPGEDGAWKLTDTAFQEIEGGGHRVEAT
AVRADGTVIPVAGIGNGPLSALTVALAKAGIGFEVVDYTENAVYSEHAVSEGADAVAVCY
IRARVEGREVWGVGMDTSVLTAMVRAAVSAVNR
Download sequence
Identical sequences C7QJN7
gi|256391537|ref|YP_003113101.1| 479433.Caci_2342 WP_012786553.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]