SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392231|ref|YP_003113795.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392231|ref|YP_003113795.1|
Domain Number 1 Region: 10-78
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000188
Family Intron-encoded homing endonucleases 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256392231|ref|YP_003113795.1|
Sequence length 131
Comment hypothetical protein Caci_3045 [Catenulispora acidiphila DSM 44928]
Sequence
MWDRIEPTMTCWIWRGYVDPDGYGQFLGRPAHRVVYERLVCGVPSDLQLDHLCRNRLCVN
PAHLEQVTTAENLRRARASRDGQMAYRAAVCRNGHEYTPKDVLANGQRKCHQCRRDGYRR
KRDADREQSSG
Download sequence
Identical sequences C7Q4I5
479433.Caci_3045 gi|256392231|ref|YP_003113795.1| WP_012787247.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]