SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392297|ref|YP_003113861.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392297|ref|YP_003113861.1|
Domain Number 1 Region: 12-329
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-17
Family Galacturonase 0.023
Further Details:      
 
Domain Number 2 Region: 433-556
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000301
Family PKD domain 0.0063
Further Details:      
 
Domain Number 3 Region: 393-463
Classification Level Classification E-value
Superfamily PKD domain 0.00000262
Family PKD domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256392297|ref|YP_003113861.1|
Sequence length 885
Comment cell wall binding repeat 2-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MSTLTATAVTDLPARAAVANAVYVFDNNFECSDTAPDAGSEATPYCTLPAALASSSVVSG
TTIMITGNVSGAIDITKSDITIEGRGTRVVGGAYGISLVGRHHVTLNGVGYQYQTGEALR
IDSSTDITVNSFGAARSQDGSTTPDPAMPAISVTGSTRVTLSDGVLQANPGPGVLVQQSS
QVVVSDTIVNGSTGGIALADSTGVDVVSDTIDENCGAGISVLGASTDVDIADNIVSNALA
CGATLGTALTVDTTAAPPTVDANILTTAAGTDAVSWQGRTFADGPALDAAGDGAHDLTVD
PGFAIQVPAGSAHRSGWDLAPGSPAIDSADSGAPNMPARDRDGAVRTDDLAVADTGTGPI
AYADRGAVELARQATPTLTVTATAGRTPSDYRTVSVAVQGDGGSWWPIVSYNVDFGDGTK
SGTRPYPEAGTAPSHTYGADKTYNGTVTVTDAHGRVFTTPFTVTLAKRVFSPSLEVDQSG
PSLGDVTALIQTTNEDDPYLGSYAIDFGDHTPTVTWTSGGVLVPTDTLRHTYAASGTYTV
TLSATDNLGWPTAQPVVQKFTVTLPVPYQPPTPIPTTVHRIGGTDRYATARLVSQAQWKA
GTASAVVLARGDQAPDALSGVPLAAHVHGPLLLTSPGSLDAATRAEIDRVTGGPSTSKTV
YILGGASAIAPGIEDSLRKAGYQVVRYEGTDRYRTSLAVAGAFGSTAHVIVATGLDFPDA
LAAGPLGAVENAPIILSKGDALDPAVTPFVRSHQDIDPVGGAAQRAVAKISTTGRTVSHS
LAGATRYDTAAAVANAVMRIAGHTTFAIGVASGKAFPDALTGGAYAANAGMPLLITDPAV
LSSAVRGVLIEEYSTLRSVTLFGGNQAVSDGVEATIANEISAKIQ
Download sequence
Identical sequences C7Q4Q1
gi|256392297|ref|YP_003113861.1| 479433.Caci_3111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]