SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392350|ref|YP_003113914.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392350|ref|YP_003113914.1|
Domain Number 1 Region: 1229-1376
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.15e-22
Family Ricin B-like 0.00068
Further Details:      
 
Domain Number 2 Region: 1501-1619
Classification Level Classification E-value
Superfamily PKD domain 2.62e-16
Family PKD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1624-1745
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000275
Family CBM4/9 0.035
Further Details:      
 
Domain Number 4 Region: 1897-2020
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000252
Family CBM4/9 0.028
Further Details:      
 
Domain Number 5 Region: 1761-1885
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000822
Family CBM4/9 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392350|ref|YP_003113914.1|
Sequence length 2031
Comment ricin B lectin [Catenulispora acidiphila DSM 44928]
Sequence
MREHRNSRIRRLRNAIVLVAAPALAITAAPIAAAGAAAAARSDQPAAAAPAAVQGPSAAA
AAKPAPAAPDPQAALRKAMAVAHAKAEQTKKQVVVEAANTAHDTMYANPDGSFNLTQDTD
AVRTDVTGSWGPIDTTLVRAADGSVHAKAAVLGITFSGGGTGALARLDDGGHRATLTWPA
ALPKPVLSGSSALYPNVYPDTDLRVTADAEGIREVLIVKTAAAAANPALSSIALGTTTSP
DLKLGTNVNGAIVATDAAGTAVFGTGTALMWDSSTSTTTALARSAAPAQQSADGPTASSA
DGPGSAAQTATMPESLTGSTIKVQPVKDLLTGKNTKFPVYIDPTAYAPLQNWAEIHSGNP
GTSYFDAEGGSQTEVMRAGWYGASGIVRSMFEYNVDTSLIPAGVDPSTMSAQFTVTSQYC
SGNPHLMDVVAIDRFFPGVTWQTALHDANGNPLGANAYAGYTSPWNGQDDTVISGGNGVY
PVDSHGATQCSGLGGIGYKLQFNDSNQVQNVYEHGGATVDVGLKFHDERDQTGLWAFFRH
DWEDGSPEYDPQNPGSAQLSITFWESPRVVGTSITPTPTAGGPCDTTGNAHGYVRKSIGN
TITVNTEIEDIDPSIPLQPLFFLNDMTNFANGTGSIIGPAVNSADKDHPGSDGWYHATQS
ATYSQQTAALHQDPSLMLNDGDTYTAGLGAIEDLSHPRSSNSEPGLNNSNDECFFTSALT
SPDKPEISSTAFPIIGQPAVSVAGAGGSFTISGKTSGVPIDHYDWALNTSASMVGNANNG
GGTVTGVGYTSGTSTLTLPVGRTTFGENTLWIRAVDVAGNYSSVSQYDFYLPGNPKATTT
LGDVTGRGVPDLVLVTPDANGNAHLVVQPGNSDPAIPPTSLPAGLQQAAIEAAPASAAPD
GHDWSNTLISHRGAARGVPVDDLYAYSLTTHALYYYLNSAVFGAAVPSDQFSRSHQVVVT
RPTCDPAVDSRNKCASYDNADWSKVKQILAFGSVTGQKAGTFAGRTNLITVEDDGNGGTN
LWLFQPAGGDQVTTPKLIGSSNLTGGYSALPGWNWANVDLIAPGTIPGDASGGTLPDLWA
RDRTTGTLWQFDNKTSNGVEDPTSLGNLNAAHAVGRVGTATTQGSYPTSSYLTLIGAGSP
TVSTDGHGTLTEGGPGAYPALWGTGQNGKLTLLPGSAGGPITTSDGPATATLADGASRNA
WTPVKQVTTLDGHDPTTSTGPIQIGWTQGTNNGGGPLCLDLPGGNAANGSPLQQYRCLNN
ANQTWTFTDDGSIRWTANQHKCLTIGSTWANNGGTANTSPLQISDCVTVTNPADPQLGAI
SSLQRFEVRQSPGITGWSQLYNPASGRCLDNGATTNSGTDPWLWDCGNGLQQAWLVPEAA
GSTQRAEAELLYNISRTGTGGLGPQADCCGVSWSGGAQEMFNNTLPSAVLTLPWYVPYKG
TYRVVPTMTSATDYGKVTLTVDAGAPNQQTLARTYDAYNPAVAVNPVDFGTIDLAAGGLH
TFTFTLNGTNAASTGNRYNIGVDTLQLVPTTSTAPVASETVTPVSSVGQPITIDDSATNP
GAASITAYAIDFGDGTSATSPTPNVATHAYSTPGTYPVKLTVTDDNGASASTTKQVIVLS
SAPVANGDFERGDLSGWSASYNSAVTTDSPHSGTYAGQINAPAGGNGSVEQVVSGLKPNT
SYTLTGWVRTDGGATILGTKEYDAADDDTGATTAATGWTQLSNQFTTGATNTSVDVYCYR
PTAGASACDDFTLLATPAAGAVGNPDFETGNLAGWNESYNAGVTTTNPHGGTYAGQINAP
TGGNGSIEQVVTGLTPNTSYTLTGWIRTDGGATILGTKDYDADPGDDTGATTTNTGWTQL
TSQFTTGTNSTSVDIYCYRSTAGTSACDDFALTQTPATVANPDFETGTLDGWAASYNADI
TTTNPRAGTYAGQLNAATGDNASIEQVVTGLTPNTAYTLTGWVRTDGNTTYLGAKQYDTA
GSVTDANTTATGWTQLTDQFTTDATGTSVDIYCYRDTAGTSACDDINLTKD
Download sequence
Identical sequences C7Q667
gi|256392350|ref|YP_003113914.1| 479433.Caci_3165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]