SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392664|ref|YP_003114228.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392664|ref|YP_003114228.1|
Domain Number 1 Region: 13-523
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 5.63e-219
Family Heme-dependent catalases 0.00000000000809
Further Details:      
 
Domain Number 2 Region: 553-665
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000000221
Family Catalase, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392664|ref|YP_003114228.1|
Sequence length 720
Comment catalase [Catenulispora acidiphila DSM 44928]
Sequence
MAVGPATAGSGADREDSKDAQLETVRAHPAQDVVTTDQGVRIDDTDNSLRAGERGPTLLE
DFQAREKLTHFDHERIPERVVHARGSAAYGYFECYEPLTELTCADFLSEAGLRTPVFVRF
STVQGPRGSADTVRDVRGFATKFYTREGNYDLVGNNMPVFFIQDAIKFPDFVHAVKPEPH
NEMPTGGTAHDTFWDFCSLQPESTHMLMWAMSDRAIPRSLRMMQGFGVHTFRFVTAEGRG
TFVKFHWRPKLGVASQVWDEAQLTAGKDPDFHRRDLWEAIESGSYPEWELGVQLVAEEDE
SRFDFDILDATKLIPEELVPVKVIGRMVLDRNPENFFAETEQAAFHTANIVPGIDFSNDP
LLQGRNFSYLDTQLIRLGGPNFSQLPVNRPVADVHTNHRDGYGQQVIHRGVSYAPNSLSG
NNPHQAGQERQPGVFKHYQQRVDGEAIRKRSESFSDHYSQATLFWNSMADWERQHIVDAF
RFELGKVETAEIRERMVGNLTHVDAGLARQVAEGLGMELPEPGDDAPRRGDQASPAASPA
LSQDNLLPGDPSTRKVALLAADGVDVALVGDLVAQLRERGVTAEVVGLHGGALSGQSGEV
STIGVDKALPTTASVLYDAVLLGGGEQSVQAVGANTDARRFVAEAYRHGKPIGALGPGIG
LLTDVTGVTGEVGADLNGEEPRSQQGLVIAASTEGGVDGFIEAFAAALSAHRFFGRESAS
Download sequence
Identical sequences C7Q967
WP_012787680.1.73754 gi|256392664|ref|YP_003114228.1| 479433.Caci_3481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]