SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392709|ref|YP_003114273.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392709|ref|YP_003114273.1|
Domain Number 1 Region: 258-343
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000314
Family PKD domain 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|256392709|ref|YP_003114273.1|
Domain Number - Region: 72-149
Classification Level Classification E-value
Superfamily PKD domain 0.00732
Family PKD domain 0.0054
Further Details:      
 
Domain Number - Region: 175-242
Classification Level Classification E-value
Superfamily PKD domain 0.00876
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392709|ref|YP_003114273.1|
Sequence length 682
Comment PKD domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MGNRLRPSVARTRLSALAVTTSLAAAGVGGIGGIGAEAAHAAVAAEATQPGGTQGEVATT
AALPILTETSRMVVRADLTGSFADTNIDLTKSAVLWGDGSKSPIAVDSGTREVSVGDHTY
TAAGVHTVVLSLVEQGASTSIANSADIAVGDVAGLSIQRSAHFGSAVPAFYNGTQADSFD
TNVTFSINWGDGHVDTTAPGESVFDLPSTHVYAVPRSAPYTAVLTVYNNGVAAAVASLPI
TINASTVQAALHLMPTAPYSVSANLAGSSVDVDAKAATYTIDWGDGTAQAPDTQTFHGVG
ATLPANPSHKYAAAGNYTVRLTVRDGLGGAATAATTVLVSAPVRPVATVTQYAGIDRYRT
SLLVSQARWANHGVADDPAHRLEANAVVLATGTAFPDALSGIPLAKAKNGPLLLTDGARA
SVDPTVLTEIQRVLPKGSMIYILGQTGAVSQGIQTELSKLGYRVTRYGGTDRYATSLLIA
QLGMQNPSHIVVARGDQGADNTGFADALSAGPLAADIFGGGDAAIVLSDNKTLTPATAAY
VKGKFADASTDVAAVGGAAVAAVATLPGSATASTPLAGTDRYDTARLVAQLFATHDPIGI
ATGLQFPDALAGGALMASLGGPLILTDPTSETAGAAGTAKAVLQFAGTTPAVNIFGGDAA
VSPGVVSVIMGQVGQGTLNRIS
Download sequence
Identical sequences C7QAD3
gi|256392709|ref|YP_003114273.1| 479433.Caci_3526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]