SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392812|ref|YP_003114376.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392812|ref|YP_003114376.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily DsrEFH-like 3.7e-17
Family DsrEF-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392812|ref|YP_003114376.1|
Sequence length 121
Comment hypothetical protein Caci_3632 [Catenulispora acidiphila DSM 44928]
Sequence
MAGKAVVSLTTGLEDAERVTVAFLVAVGAAEQGRETLMFLTKEAVRLATDGVARAVACEG
CPALDELVKRYESAGGSFLVCPICFTTRHLDEGSLVANAALGGTIPMWEWIGDEPATTFS
Y
Download sequence
Identical sequences C7QBR6
gi|256392812|ref|YP_003114376.1| WP_015792264.1.73754 479433.Caci_3632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]