SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392817|ref|YP_003114381.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392817|ref|YP_003114381.1|
Domain Number 1 Region: 6-489
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.32e-194
Family Heme-dependent catalases 0.000000000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256392817|ref|YP_003114381.1|
Sequence length 493
Comment catalase [Catenulispora acidiphila DSM 44928]
Sequence
MDLTPRPRVLTTESGAPVADNQHSASAGPAGPLLIQDQQLLEKLARFNRERIPERVVHAR
GAGAYGYFEVTADVTGHTRAAFLSEPGKRTEVVARFSAVTSSLGSADATRDIRGVAARFY
TEEGNYDMVGNNTPIFFIRDPMKFPDLIHSQKRDPYTGTVEPENVFDFLAHTPEATHQVT
WLYGDRGIPADYRHMDIYSSHAFQWENAEGVRSWVKYHFKSDQGIANLHSEQARRVAGEQ
PDSHQQDLLKAIEAGDFPSWTLYVQVMPESDADGYRFNPFDLTKVWPHADYPLIEVGRMV
LDRNPEDVFTEIEQVACNPANFVPGIGPSPDKMLQGRLFAYADAHRYRLGVNNMQLGVNR
PRGTTADNYGRDGFMRADTPGPHRGRARDRNYEPNSFGGPVQTDRPLVGGGEVAGRVGSH
ATPSHREDDDYRQAGDLYRLMSQDERARLATNLAAPLAAIDRTDIVERFIAHLRAADEEY
GERVEQAVAATRG
Download sequence
Identical sequences C7QBS1
WP_015792269.1.73754 479433.Caci_3637 gi|256392817|ref|YP_003114381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]