SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256392888|ref|YP_003114452.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392888|ref|YP_003114452.1|
Domain Number 1 Region: 45-118
Classification Level Classification E-value
Superfamily PKD domain 0.000000017
Family PKD domain 0.0024
Further Details:      
 
Domain Number 2 Region: 220-312
Classification Level Classification E-value
Superfamily PKD domain 0.000000366
Family PKD domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392888|ref|YP_003114452.1|
Sequence length 643
Comment PKD domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MPSPSRSRLSTIAVATLACTAGGMSAAVPSHADTTVSAGLSVPSEVSISSATVTADISGS
EAPAGATYTIDWGDGVQSVTSDKDTPLTHTYTRVGGFGVTLKVTSSDDNDQQRVPVTVDP
VGGAVAASATSLVDRSPITVTITPPSRLGTGESVTGYSVDLDCGAGQTSTYSISAGSDLS
VTEPVHCIGKVLVSVQGTLNDGGHFWLDGPTLTVTAAQPVLHASVTVTAPHTVQVDLAGC
SVDFAPSSYPMFSIDWGDGTSLKNDDLASASLHQSMPTHWYTTAGTKTVTIWIGDGVGPS
ATTTRTITLTDPAVTATVQPVAGADRYATGVLASQRAFPAAGSAGAVVLARGDQFADALT
GIPLASYRHASLLVTPGGPGATLDPRVAAEIQRVLGPGTGKTVYLLGGTAALPQGIADYI
TKTLHYRVVRYAGTDRYATALIIAKTGLDNPGRIVAARGDDFADALTAGPLAADKLTDAS
GKPAAIVLTQGPAEKATVDPATAAYIRSKERTAGAVTAVGGGAWTALQQPAMYVAGAVTG
IVGGDRYGTATAVANAWGTNTQNKYTIGLATGTGFADALTGGALTAHANGPLLLTDPAVL
SPATANYLRAYGTSIATIDVFGGPTAIAPTVINAVYQQLSMPY
Download sequence
Identical sequences C7QBZ2
479433.Caci_3709 WP_015792340.1.73754 gi|256392888|ref|YP_003114452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]