SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256394532|ref|YP_003116096.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394532|ref|YP_003116096.1|
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Cgl1923-like 1.11e-82
Family Cgl1923-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256394532|ref|YP_003116096.1|
Sequence length 302
Comment hypothetical protein Caci_5396 [Catenulispora acidiphila DSM 44928]
Sequence
MIEFDGNMPDLVDPVAICAFEGWNDAGEAASNAVKHLAEAYAGAGRMFAALDGEDYYDYQ
VHRPMVAAVDDRRQVIWPTTRFSVVRAPARLLPGDAHEEPRDLVLVHGVEPNMRWRSFCE
EVLGLARDLGVGQIITLGAYLADVPHTRPTPVTGTSSDEAYQALFDVEPPTYEGPVGITG
VFQEACHHAGIPLMSFWAAVPHYVAHPPVPKATLALLRRLEDVLDLSVPTKRLAEEAQSW
EAGVDELAENDAEVGEYVRTLEEQRDNEDAADSPEASGEAIAREFERYLRRQERRRGSSE
EG
Download sequence
Identical sequences C7Q9A9
gi|256394532|ref|YP_003116096.1| WP_015793984.1.73754 479433.Caci_5396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]