SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256394602|ref|YP_003116166.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394602|ref|YP_003116166.1|
Domain Number 1 Region: 7-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.27e-17
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 97-163
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 1.83e-17
Family C-terminal domain of arginine repressor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256394602|ref|YP_003116166.1|
Sequence length 168
Comment arginine repressor [Catenulispora acidiphila DSM 44928]
Sequence
MSEATVPQTRTARHQRIALLLERHSVRSQAELGRLLAEDGLSVTQATLSRDLDELGAVRV
RDGASNLVYAIPAEGGDRTPVAAQPEPVFEHRLHRLLGELLVSAEASANLVVVRTPPGAA
QFLASAFDKAQIPEILGSIAGDDTVLLISRDPDGGTALAAKLLAAAEN
Download sequence
Identical sequences C7Q9H9
gi|256394602|ref|YP_003116166.1| WP_015794054.1.73754 479433.Caci_5466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]