SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256395266|ref|YP_003116830.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395266|ref|YP_003116830.1|
Domain Number 1 Region: 53-349,411-449
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.26e-83
Family Type II chitinase 0.000000964
Further Details:      
 
Domain Number 2 Region: 351-413
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000128
Family Chitinase insertion domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256395266|ref|YP_003116830.1|
Sequence length 455
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MARPSQHHRNRRVGLAAAAVLSLAIVPVAAASPALATPGSAAASAAASASSASSNGKVSV
GYFTQWGIYSGFYEKNLIASGAVKKLTEIDYAFSNIAPDGTCASADAWADWQKPVDAANS
VDGTADTGAQSIAGNFNQLRELKKAYPNLKIVMAIGGWSESTNFSAAAATPASRAKFAQS
CIDMYIKGNLPGVAPGAAAGIFDGISIDWEYPDGVGDNNPHGPQDTHNFTLLLQELRNQL
DTAGRPDGKHYLLTADMPAGPENVSHIEIGAVSRILDWMNVMTFDFHGTWETTGPTNFQS
NLFPSPFDPAPRATSSNPFPVNGEISTLQVVMNYLQHGATPNKIALSIPLYAHGWTGVAP
GPRGDGLYQPATGVATDVVYNQVAAQPGTVHHDPITGAVYKYDPASKTFWTYDDPQSIQE
KVLFIKALGLRGDMAWSMDGDTADGALVNAFGLAK
Download sequence
Identical sequences C7QIB2
gi|256395266|ref|YP_003116830.1| WP_015794718.1.73754 479433.Caci_6135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]