SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256395288|ref|YP_003116852.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395288|ref|YP_003116852.1|
Domain Number 1 Region: 466-555
Classification Level Classification E-value
Superfamily PKD domain 1.44e-21
Family PKD domain 0.0011
Further Details:      
 
Domain Number 2 Region: 563-645
Classification Level Classification E-value
Superfamily PKD domain 5.1e-21
Family PKD domain 0.0011
Further Details:      
 
Domain Number 3 Region: 650-747
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-19
Family Fibronectin type III 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|256395288|ref|YP_003116852.1|
Domain Number - Region: 264-415
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0876
Family Arylsulfatase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256395288|ref|YP_003116852.1|
Sequence length 918
Comment fibronectin type III domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MIRRKRWIAGAAFLALIAGGSIGAAQGLQSTRPSSGPGSCTLIGWNPSTDPTNAKNLPVG
QRPQSYRPDNFDCSSAKFAALGSEFTKFPQPHDFSVNNRITYEPAAAGKPATAIQQPVAA
VNPLTPYFPPFQHFVIVYRENHTFDDYLGDCATTISASCNGKVQSTNHISSVPDLHSLAK
TYALSDSYSTGTQPPSGPNHWWLFSAQSQSSSQQQTYPSTGTEFDRFLSNTNGPTNEGTN
ACTAPTGNGSGSSPYTFVMNGDFYWMLSSGSGYWKNPADGKTEVLPPNRPGTSIPEELHY
NEYTCSNQSLPDSTIANDYINFVNTNGLPVYSYVELFNDHPGTYQDIPGNDTATNNVVNA
IENNATYKNNTLIIVTEDDTQNGNNGTDHVSNTYRVPLVVIGPSQYVKQGYVSHVAYTTN
NVIAAMERTMQNVKAGIIDPNDNIGLNTFPMTTNDQAALGDPLEDFWVQGSTPLSASATA
SPTTGNAPLAVNFTGSATGGTAPYKYSWNFGDGATSTTQSPSHTYSSAGSYTATLTVTDT
SSPVKTATSQVAVNVSSVGSPLAASAAGTPTSGQIPLAVNFTGTATGGTPAYHYSWNFGD
GSATSTAQNPSHSYTAAGTYTATLTVTDSASPVNTATSTVSVTASPIMGTPPSAPQNLTA
AAGTNQVTLNWQAPASSGGENITKYSVYRGTSSGTESLVTSGGCSGVSGSTLTCTDTGLT
SGVDYYYRVTASNPIGEGGQSNEVTATPTGSTGCTAGQLLGNPGFENGASNPAPWAITST
HTPLSVINSSSSEPPHGGTYDAWIDGWGKATTDTLAQTVTLPSGCTTEKLNFYMHIDTAE
TTTTTKYDTLKVQVLNPAGTVLGTLYTYSNLNANTGYSLHSLSLASYAGQTVTLKFTGVE
DAEYQTSFVVDDATVNVS
Download sequence
Identical sequences C7QID4
479433.Caci_6157 gi|256395288|ref|YP_003116852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]