SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395435|ref|YP_003116999.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395435|ref|YP_003116999.1|
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.84e-45
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 147-310
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 2.88e-34
Family GAPDH-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256395435|ref|YP_003116999.1|
Sequence length 343
Comment N-acetyl-gamma-glutamyl-phosphate reductase [Catenulispora acidiphila DSM 44928]
Sequence
MVRVTVAGAAGYIGGELLRLLLGHPEIEVVGAVSSRFPGRRIDGVHPNLRSATDLSFCAT
EDVPESDAVFLALPHRVAMTQIEQWTQRSKLVIDLTGDFRLDDTAVYERYYDEEHQAPHL
LDEFTPGLPELYRDQLRTADLISVPGCMATAGVLALYPLVAHDLIDPEQGAQFDARTGSS
GSGATAGPANLHAERSGAMRVFAPTRHRHEAEISRHLGLSAAMTATGVEAVRGAQSLCHA
TLREGVDEQQVRRAFRRQYSAEPFVRVVAHQRGIHRYPDPKILLGSNFCDVGFAVDADTG
RLTTIAALDNLVKGGAGNALQCLNIRLGLPETLGLSFPGLHPL
Download sequence
Identical sequences C7QK84
479433.Caci_6304 WP_015794887.1.73754 gi|256395435|ref|YP_003116999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]