SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256395691|ref|YP_003117255.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395691|ref|YP_003117255.1|
Domain Number 1 Region: 27-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-16
Family Pectate transeliminase 0.082
Further Details:      
 
Domain Number 2 Region: 490-550
Classification Level Classification E-value
Superfamily PKD domain 0.000000000366
Family PKD domain 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|256395691|ref|YP_003117255.1|
Domain Number - Region: 402-462
Classification Level Classification E-value
Superfamily PKD domain 0.000275
Family PKD domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256395691|ref|YP_003117255.1|
Sequence length 871
Comment cell wall binding repeat 2-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MSISALSIAALGAPMAAAADSDTTAPVTLRVGFTGTCSDAAPRADSALYCTLAGATAAAQ
PGDSVLVGELGATDKIAGSGAPGKPITVFSHYADQTFTDNSWQTVVSVTGQHDVVVRDIR
LGGLDASGSSALTVNHVLVTPLNSAADNRLAPFGIRLSATTDSTVTDSHIDADNTDGTNL
AVGILVENGSDRTTVSGTIIGEVYGTGIQVTDSKDVRLISDTAADDIAGVVLSGASTGAV
VENDIFADGGPQPSLTVAATAIANTLVGHNLFGSGSPTTSVLWGTSAYATGQAFDSAHLG
SADLDGAAQLDTSNDPDWPATPQEYFVAPSYRLTWNSPAIDSADAAVPGEPAVDRVDDPD
VADTGSGPAGYVDRGAREFTGMQIRPFTATAALGVSPQDYLDATVNTDGMFQWSGPVSAL
YSYGDGSAATSQSTHHYPAAGTYHGTVTFTGQKGETATANFTASPAATKVTPAVSAFQPD
ANDPHLVSVSASWGPGATYDFEFGDGQSDKNNYTGYSDHRYAASGTYTVTVTVRDQNGWT
GTASTQVTVTIPGGTPPPPPPAGAGGTVTRVGGRDRYETAIDASLRQFPGGTAKAVVLAR
GDAFADALAGGPLAARVGGPLLLTDPKNLGTPTAAEIDRALGHDHSRTVYLLGGESAISP
AVEKQVRALGYRIVRYGGASRYDTALKIAQDGMGATATVVVARGDDFADALAAGPLAANR
GAVLVLSNKNRLDPATAAFVQAHQTVIAVGGPAWDAVAKQIPAKGKQIETAVGNDRYATA
ANTVRLFHLSAVTLFGVATGTTFPDALSGGALMAAAGQPLLLTNPNVLPPDTAQQLTADG
KRKENVTLFGGQAAISDFVEEQIAALVELRP
Download sequence
Identical sequences C7PYC4
gi|256395691|ref|YP_003117255.1| 479433.Caci_6568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]