SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395852|ref|YP_003117416.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395852|ref|YP_003117416.1|
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000317
Family Actinorhodin biosynthesis monooxygenase ActVa-Orf6 0.053
Further Details:      
 
Weak hits

Sequence:  gi|256395852|ref|YP_003117416.1|
Domain Number - Region: 74-100
Classification Level Classification E-value
Superfamily gpW/gp25-like 0.0366
Family gpW/gp25-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256395852|ref|YP_003117416.1|
Sequence length 102
Comment antibiotic biosynthesis monooxygenase [Catenulispora acidiphila DSM 44928]
Sequence
MIARMWRGWASAATADDYQRHYESEVAEHLRQVPGFRGARLLRGADGEEVLFTSIVVFAS
MDDVRGFAGDDPGRAVVEETARRALTRWDERVTHHDVAVDLG
Download sequence
Identical sequences C7Q082
gi|256395852|ref|YP_003117416.1| WP_015795304.1.73754 479433.Caci_6729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]