SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256395871|ref|YP_003117435.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256395871|ref|YP_003117435.1|
Domain Number - Region: 369-505
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.000327
Family Fucose-specific lectin 0.053
Further Details:      
 
Domain Number - Region: 326-368
Classification Level Classification E-value
Superfamily PKD domain 0.0785
Family PKD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256395871|ref|YP_003117435.1|
Sequence length 727
Comment hypothetical protein Caci_6749 [Catenulispora acidiphila DSM 44928]
Sequence
MHPPAGAGQFDNSLIATTALAYVGRWGGQACVDANRFRSGQCREFVDCVVSLASGGKIWP
VDPGGNYQVGFSSVGAVPVAPAAAAEGDIIQIGDHDESNPLHTAIVLTNHGNGTFTVVDS
NWVGEPLVKELVGVHDWTPPAAAQFWRLGAVNPNNPGWHMPKGGLTGGSGLIGNQAPDTA
INPPPPAPTASTNTVNGLASGIITVRSADADPAHPAVRMQYWIDGKSGQALDNAPGGALL
SLDTTKLSDGPHVITTQAMAADGAISPLSAPVTITVTNHQLTIAVAAPNAPLLSGTVPLG
VGAAPAADLATETLTLDGVAQQEPMTTSNQLNLDTTTLTAGQHQIKVAVTNREGQTVTWG
PVIVTVTGAATGPRAVLPSATAGHADLVAVDATGRLLRYPWVSDGTFGVPQPVADGFADV
TSLVAGHFAGPAGAVQLLAVRKDGSAHLYSFDAAGKAVDQGAVNGPIWNNYTRLTAGVFT
KGGQEQLVGTDAVGHAQLITITVPPAVIPATPATPATPTVPATPTAATSPASPASPTSPA
SPASPASPASPAGALPGAATTSLPGSGDTPLSRRTDPHPAVAPAAVVTAKPAITTAIQGL
PQSPVLAGAVTIQAVPGADGIDELVSADATGAVATFTFGGAQGFVPVASAPGAPAAVRLP
APVGTPVVGGFVGKDQEILVTGADGQTWLLSLAHPERPAQGAAFQSDAVVPPTQPAQSQH
RLSQPAG
Download sequence
Identical sequences C7Q1P3
479433.Caci_6749 gi|256395871|ref|YP_003117435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]