SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256396148|ref|YP_003117712.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396148|ref|YP_003117712.1|
Domain Number 1 Region: 27-341
Classification Level Classification E-value
Superfamily Aldolase 1.83e-98
Family HMGL-like 0.000000000423
Further Details:      
 
Domain Number 2 Region: 481-583
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 6.67e-35
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 409-458
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.00000000000000251
Family DmpG/LeuA communication domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256396148|ref|YP_003117712.1|
Sequence length 585
Comment 2-isopropylmalate synthase [Catenulispora acidiphila DSM 44928]
Sequence
MRVQPQLPSGMPIHKYVPFAPIALADRTWPTKVVDRAPRWCAVDLRDGNQALIDPMSPAR
KLKMFELLVAMGYKEIEVGFPAASQTDFDFVRQIIDEGRIPDDVVIQVLTQAREELIERT
FESVRGAKQAIVHLYNSTSTLQRRVVFGQDTAGITQIAVNGAKLCQKFYEAMPPRADGTR
TDIYFEYSPESYTGTELEYAVEVCDAVTEVWQPTPDRKVIINLPATVEMATPNVYADSIE
WMHRNLERRDSIVLSLHPHNDRGTAVAAAELGYQAGADRIEGCLFGNGERTGNVCLVTLG
LNLFSQGVDPQIDFSDIDEVRRTVEYCNQLPVHPRHPYGGDLVYTAFSGSHQDAIKKGFE
HLERDAAAAGKTVDEIVWAVPYLPIDPKDVGRSYEAVIRVNSQSGKGGVAYILKTEHQLD
LPRRAQIEFSQVIQAKTDAEGGEVTPEEIWNVFVDEYLPLSEYGAPPRAAAPWGRIRLLG
HHASSAIEEKDQLTVDLQVDGSTTQLDGVGNGPIDAFTNLLSGVGIDVRVLDYVEHALTS
GEDAKAASYVECAIGSRVLWGVGIDANIVTASLKAIISAVNRAFR
Download sequence
Identical sequences C7Q5A2
479433.Caci_7041 gi|256396148|ref|YP_003117712.1| WP_015795599.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]