SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256396372|ref|YP_003117936.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396372|ref|YP_003117936.1|
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.69e-25
Family DNA-binding N-terminal domain of transcription activators 0.0016
Further Details:      
 
Domain Number 2 Region: 119-270
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000000000288
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256396372|ref|YP_003117936.1|
Sequence length 274
Comment MerR family transcriptional regulator [Catenulispora acidiphila DSM 44928]
Sequence
MGSFLSIGDFSRATHLTVKTLRHYHDVGLLEPADIDPVTGYRRYTVGQIPAAQVIRRFRE
LGMPLEEIRTVMDAPDVDTRNQHIAAHLNRLEAELGRTQRAVASLRDLLAPGEADAVPDI
TLREAPAIHAAAVTETVAMTDGAAWMQGALGELYATVAGQGLAQTGPAGGLFTDAVFTAH
HGESTVFVPCEGPVRPLGRVRPAEVPAAELAVIEHAGPPIESDRAYGALAAYVERHALAV
QGPIREYYLVGQRDTADVTRWRTEVCWPVFRVGS
Download sequence
Identical sequences C7Q8A7
479433.Caci_7266 gi|256396372|ref|YP_003117936.1| WP_015795823.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]