SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256396564|ref|YP_003118128.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396564|ref|YP_003118128.1|
Domain Number 1 Region: 461-698
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00000000000000196
Family Fucose-specific lectin 0.014
Further Details:      
 
Domain Number 2 Region: 385-460
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000103
Family PKD domain 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|256396564|ref|YP_003118128.1|
Domain Number - Region: 242-332
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000893
Family CHAP domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256396564|ref|YP_003118128.1|
Sequence length 975
Comment PKD domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MPRTRTRPRFGRALVPILATLTLTAATVLPATASAAGADPSQSTATAPAATSTAASLTQA
FAAGRHVDDTAIGGIRDGSLHTGAADGRTWAIAAFATAETAKPQEAVGLQDADTGVFVQT
GSSWHLVSTGLYGCAVGLPAALKTAWGISASSVCTGSAPAEQAQARKALAADTQAATTPA
DTTPLGQKIADIALSQVGVQTDPPVPNFSTIDCDPYSTLVAGFSSDSDGCGFDSSFNVRN
QNETWCADFAKWVWQQAGVTADMNTLNAGAVSFHTWAVHQGQNPQANSGTPEPGDAVLFY
SPGRLPNGFADHVGLVSAVHPDGSIDMVNGDFSGGAAVNVQYDQNITDLAAFAASVEGPG
EQWALVTPPTTAQQPNPAGTMDAATVAVDGATARFHASGSVPGGTITGYYWTFGDTRMTN
ETGADVTHVFSEPGTYTATVTITSSFGTTTTVRKNIQVLAASAAIATAPTDQIWYDPLPV
VQYTFVRSQGGLAVDYWNGGQWIQWSVPGTPDATGNITALTFPDAANRWVNTAHAFYRTA
GGGLAETTQTPTGWQTQALPGTAIAGGAVNATTTADGSVEVFFVNAHRQLSADVQSASGW
TTHVLDPAPVAQPGSLVLADTTSGPVILGIGPGGLVTSSTDIGPAWITVPMAAFAAKGSS
LAAATTASGTAEVFYTTPSGTLGTATQDGPRWKPSTLPGSPAAKTGKSATTYLLPSVLPA
VVGDFPQPPGTLTDTSVSAPLGMEVFYLTASGAPGVTYNDGTGWQTKTLPGSADGIVGAS
AYQVDEEPSNLYLTTGSTITEETTGARSGDPSGSWSTAPALPTAPSTWANQIVLYAADAA
DATTARAAADAAGLPAQQVTTSFATAWADTLDGNYLVYAVGTPAVRALYSNVCNWANPSD
LPGPGTPFSYGVDPVNSVAQLGAGNFVNAAGATATDTQAIATDLAYYALHGVLPPGVTSV
PPQVGAPYACMGSPS
Download sequence
Identical sequences C7Q9W8
gi|256396564|ref|YP_003118128.1| 479433.Caci_7462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]