SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256396625|ref|YP_003118189.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256396625|ref|YP_003118189.1|
Domain Number - Region: 94-164
Classification Level Classification E-value
Superfamily DsrEFH-like 0.0553
Family DsrH-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256396625|ref|YP_003118189.1|
Sequence length 175
Comment hypothetical protein Caci_7523 [Catenulispora acidiphila DSM 44928]
Sequence
MLWRVGDLSGVPEEVAGADVPVVVSFVSTARTAVVTELGDALATVLWVGVVVAAGCAAAF
RDATVVLPVVSVLLVIAVALGHYRKLRVAGRLRPAPVTVAFDEDGVTYAVSGKIAKLPWL
QWRRAYRRFGIWHLKLTAAPTRGLAFPDKVLEPEQRARLVDLLEDHNLLRNGRRY
Download sequence
Identical sequences C7QB57
479433.Caci_7523 WP_015796073.1.73754 gi|256396625|ref|YP_003118189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]