SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256397417|ref|YP_003118981.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256397417|ref|YP_003118981.1|
Domain Number 1 Region: 96-161,190-309
Classification Level Classification E-value
Superfamily MetI-like 1.55e-16
Family MetI-like 0.0073
Further Details:      
 
Weak hits

Sequence:  gi|256397417|ref|YP_003118981.1|
Domain Number - Region: 12-87
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.00654
Family Heme-dependent catalases 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256397417|ref|YP_003118981.1|
Sequence length 327
Comment binding-protein-dependent transporters inner membrane component [Catenulispora acidiphila DSM 44928]
Sequence
MGAFIVRRLLNYVVLVFVATSLAYLGASSAFHPKDMYLQKNPPTPAVVMYHELDQRNENP
QKPVLERYAHWVGGVAHGDFGQTWQLDSVGKHFSISVWVTVRLVSVAAILSAVLGILIGS
FQAVRQYKFSDHAITFGSYIVFAMPVFVLAPLLKLIAVQVNKAVGGDTPFLQYQGEIDPN
ASGFFGQLFSRADHLLLPTISLTLGLIAFYSRYQRGQMLDVLGSDFLRTARAKGLTKGRA
ILKHGVRTAVIPVMTLVTYSTILTFAGAIITERVFGWNGLGSWFTDATNHSDVNSVAVIT
LFSAVLVLIAGMLSDVITAVLDPRVRL
Download sequence
Identical sequences C7QKP1
479433.Caci_8317 gi|256397417|ref|YP_003118981.1| WP_015796865.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]