SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256397445|ref|YP_003119009.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256397445|ref|YP_003119009.1|
Domain Number - Region: 25-63
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00288
Family NfeD domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256397445|ref|YP_003119009.1|
Sequence length 83
Comment hypothetical protein Caci_8345 [Catenulispora acidiphila DSM 44928]
Sequence
MRKVPDEAVIGCVGELHVGTRGARGPGEAVVRVRGGTEAFLAWSEQPLPKGTRILVVESR
GQRAVDVIAFPESTDPLDELDRL
Download sequence
Identical sequences C7QKR9
gi|256397445|ref|YP_003119009.1| 479433.Caci_8345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]